• Cheap Sermorelin Acetate CAS 86168-78-7 Polypeptides Pharmaceutical Hormone for Body Building wholesale
    ...Product Description Quick Details of Sermorelin Product name Sermorelin Other Name SERMORELIN;SERMORELIN ACETATE;GH RELEASING FACTOR (1-29), AMIDE, GRF (1-29) NH2 Original China CAS 86168-78-7 Molecular formula ... more
    Brand Name:SD
    Model Number:99%
    Place of Origin:shenzhen,china

    Sermorelin Acetate CAS 86168-78-7 Polypeptides Pharmaceutical Hormone for Body Building

  • Cheap Sermorelin Acetate CAS 86168-78-7  GMP Standard  2mg Vials 99% Purity wholesale
    ...Supply High Purity steroid Peptide Hormone Sermorelin / Sermorelin Acetate 2mg Vials for Fat Burning Sample Free Base information of Sermorelin acetate Chemical Name: Sermorelin acetate CAS No : 86168-78-7 Sequence :H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr... more
    Brand Name:MOBELBIO
    Place of Origin:China
    Certification:GMP,ISO

    Sermorelin Acetate CAS 86168-78-7 GMP Standard 2mg Vials 99% Purity

  • Cheap LGRF 1-29 Sermorelin Acetate Peptides For Fat Loss And Muscle Gain CAS 86168-78-7 wholesale
    ...Peptide Hormones Sermorelin 2mg/vial GRF 1-29 CAS 86168-78-7 For Weight Loss Sermorelin Acetate Sermorelin Properties alpha D20 -63.1° (c = 1 in 30% acetic acid) storage temp. −20°C Abstract Sermorelin (INN) (trade name is Geref), also... more
    Brand Name:YUANHANG
    Model Number:86168-78-7
    Place of Origin:CHINA

    LGRF 1-29 Sermorelin Acetate Peptides For Fat Loss And Muscle Gain CAS 86168-78-7

  • Cheap Sermorelin GRF 1-29 Human Growth Hormone Sermorelin Acetate for weight loss wholesale
    ... Molecular formula: C149H246N44O42S Molar Mass: 3357.96 CAS number: 86168-78-7 PubChem: CID 16133753 Synonyms: Sermorelin acetate hydrate, GRF 1-29 NH2 Sermorelin Acetate 2. Description: more
    Brand Name:steriodshow
    Model Number:86168-78-7
    Place of Origin:china manufactuer

    Sermorelin GRF 1-29 Human Growth Hormone Sermorelin Acetate for weight loss

  • Cheap Pharmaceutical Powder Polypeptides For Muscle Building Sermorelin Acetate Hydrate wholesale
    ... Building Sermorelin Acetate Hydrate Quick detail Sermorelin 2mg (GRF 1-29) Peptide Molecular formula: C149H246N44O42S Molar Mass: 3357.96 CAS number: 86168-78-7 PubChem: CID 16133753 Synonyms: Sermorelin acetate hydrate, GRF 1-29 NH2 Sermorelin Acetate... more
    Brand Name:YIHAN
    Model Number:Sermorelin
    Place of Origin:hina

    Pharmaceutical Powder Polypeptides For Muscle Building Sermorelin Acetate Hydrate

    Yihan Industrial Co.,Ltd.
    [Hongkong,China]
  • Cheap 2MG / Vial Sermorelin Acetate Cas 86168-78-7 White Lyophilized Powder wholesale
    ...2MG / Vial Sermorelin Acetate Cas 86168-78-7 White Lyophilized Powder Protein Peptide Hormones Quick Detail; Alias:Sermorelin Acetate Hydrate CAS: 86168-78-7 MF: C149H246N44O42S MW: 3357.96 Purity: 99% Specification: 2mg/vial Appearance: ... more
    Brand Name:Muscle Man
    Model Number:400
    Place of Origin:Hunan,China

    2MG / Vial Sermorelin Acetate Cas 86168-78-7 White Lyophilized Powder

  • Cheap 99% Purity Anti-aging Bulking Cycle Human Peptides Sermorelin Acetate With 2mg/vial for Muscle Gainning wholesale
    ...99% Purity Anti-aging Bulking Cycle Human Peptides Sermorelin Acetate With 2mg/vial for Muscle Gainning Welcome inquiry and order samples, special gift is ready ... more
    Brand Name:HongKong Blue
    Model Number:CAS No.: 86168-78-7
    Place of Origin:CHINA

    99% Purity Anti-aging Bulking Cycle Human Peptides Sermorelin Acetate With 2mg/vial for Muscle Gainning

  • Cheap Bodybuilding Anabolic Steroids Sermorelin Acetate Peptide White crystalline Powder wholesale
    ...Bodybuilding Anabolic Steroids Sermorelin Acetate Peptide White crystalline Powder Introduction: GH-releasing peptides (GHRPs) are synthetic peptides that like GHRH ... more
    Brand Name:Sermorelin
    Model Number:87616-84-0
    Place of Origin:china

    Bodybuilding Anabolic Steroids Sermorelin Acetate Peptide White crystalline Powder

    Pharmlab Co.,Ltd
    [Hubei,China]
  • Cheap White Powder Releasing Human Growth Peptides Sermorelin Acetate GRF 1-29 wholesale
    ... Peptide Sermorelin Acetate GRF 1-29 Product Name:Sermorelin Acetate,GRF 1-29 Alias:Somatoliberin,Sermorelin ,Sermorelinum,Sermorelina,Sermoreline CAS No.: 86168-78-7 Molecular Formula: C149H246N44O42S Sermorelin Molecular Weight: 3357.96 Sermorelin Purity... more
    Brand Name:Yuancheng
    Model Number:86168-78-7
    Place of Origin:WUHAN

    White Powder Releasing Human Growth Peptides Sermorelin Acetate GRF 1-29

  • Cheap Sermorelin Acetate Bodybuilding , Growth Hormone Peptides Sample Available wholesale
    ...High Purity and 2016 Newly Produced Sermorelin Improving Sleep Basic Info Port: China Production Capacity: 1000vial/Week Payment Terms:T/T, Western Union, Money ... more
    Brand Name:HBYC
    Model Number:HBYC
    Place of Origin:China

    Sermorelin Acetate Bodybuilding , Growth Hormone Peptides Sample Available

  • Cheap Sermorelin Acetate Human Growth Hormone Peptide For Improving Sleep Quality wholesale
    ...Bodybuilding Peptides Sermorelin Acetate 2mg/vial Human Growth Hormones For Fat Loss Description Sermorelin is a GHRH (growth hormone-releasing hormone) peptide analogue. Its peptide sequence is comprised of 29 ... more
    Brand Name:Yihan
    Model Number:86168-78-7
    Place of Origin:China

    Sermorelin Acetate Human Growth Hormone Peptide For Improving Sleep Quality

    Yihan Industrial Co.,Ltd.
    [Guangdong,China]
  • Cheap Finaplix H / Revalor-H Trenbolone Acetate Trenbolone Raw Steroid Powder Shipping Guaranteed wholesale
    ... Step Guide For Making Tren Ace 100 Oil. The recipe for 1000 ml of trenbolone acetate @ 100 mg/ml we use: powders: 100 grams; BA: 2%, 20 ML BB: 10%, 100 ML... more
    Brand Name:TINGYI
    Model Number:10161-34-9
    Place of Origin:China

    Finaplix H / Revalor-H Trenbolone Acetate Trenbolone Raw Steroid Powder Shipping Guaranteed

  • Cheap Injectable Growth Hormone Muscle Buildig Peptides  Sermorelin Acetate 2mg/vial wholesale
    ... Hormone Sermorelin 2mg Sermorelin Acetate Sermorelin acetate is a human growth hormone-releasing hormone (GHRH or GRF) used for diagnostic evaluation of pituitary function and also for increasing growth in children. Off label usage of sermorelin acetate... more
    Brand Name:Shuangbojie
    Model Number:Sermorelin Acetate
    Place of Origin:China

    Injectable Growth Hormone Muscle Buildig Peptides Sermorelin Acetate 2mg/vial

  • Cheap Sermorelin Acetate Powder wholesale
    ... purity Atosiban Acetate Deslorelin Acetate Desmopressin Acetate Gonadorelin Acetate/GnRH Leuprorelin Acetate Melanotan ② Octreotide Acetate Oxytocin Acetate Salmon Calcitonin Sermorelin Acetate Teriparetide Acetate Triptorelin Acetate Thymosinβ4(human... more
    Place of Origin:China
    Delivery Time:3 days
    Payment Terms:WU, t/t

    Sermorelin Acetate Powder

  • Cheap Manufacture fresh stock Sermorelin Acetate with competitve price anf quality guarantee wholesale
    ...Product Description Name: Sermorelin Acetate Cas No: 86168-78-7(net),114466-38-5(acetate) Formula: C151H250N44O44S Molecular:3417 Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ Purity:98% Appearance: white powder Source: synthetic Also known ... more
    Brand Name:Youngshe
    Model Number:YSPI
    Place of Origin:Chengdu , China

    Manufacture fresh stock Sermorelin Acetate with competitve price anf quality guarantee

  • Cheap Sermorelin Acetate wholesale
    ...Product Name Sermorelin Acetate Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu-... more
    Brand Name:YC
    Place of Origin:wuhan china
    Certification:ISO9001

    Sermorelin Acetate

  • Cheap High Purity Raw Powder Sermorelin Acetate Peptide for Weight Loss CAS:86168-78-7 wholesale
    ...Specification: Product Name Sermorelin Sermorelin CAS 86168-78-7 Sermorelin Alias Sermorelin Acetate Sermorelin Molecular Formula C149H246N44O42S Sermorelin Molecular weight 3357.96 Specification 2mg/vial Apperance white powder Assay 98% Storage 2-8 degree... more
    Brand Name:JNJG
    Model Number:86168-78-7
    Place of Origin:CHINA

    High Purity Raw Powder Sermorelin Acetate Peptide for Weight Loss CAS:86168-78-7

  • Cheap Anabolic Steroids Sermorelin Bodybuilding , Sermorelin Acetate 2mg White Powder Peptide wholesale
    ...Anabolic Steroids Sermorelin Bodybuilding Sermorelin Acetate 2mg White Powder Peptide Product Data: Product name: Sermorelin Sequence: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-... more
    Place of Origin:China
    Minimum Order Quantity:10vials
    Price:nigotiate

    Anabolic Steroids Sermorelin Bodybuilding , Sermorelin Acetate 2mg White Powder Peptide

  • Cheap Sermorelin Acetate Hydrate Increase Human Growth Hormone In Sport GHRH wholesale
    ... In Sport GHRH Sermorelin Sermorelin Acetate, also known as GRF 1-29, is a Growth Hormone Releasing Hormone (GHRP) produced by the brain that stimulates the production and release of Growth Hormone (GH). Sermorelin Acetate was first... more
    Brand Name:KANGDISEN
    Model Number:2 mg/vial
    Place of Origin:China

    Sermorelin Acetate Hydrate Increase Human Growth Hormone In Sport GHRH

  • Cheap 2MG / Vial Sermorelin Acetate Cas 86168-78-7 White Lyophilized Powder wholesale
    ...2mg/vial Sermorelin Acetate CAS: 86168-78-7 Peptide Steroid Hormones White Lyophilized Powder Quick Detail; Alias:Sermorelin Acetate Hydrate CAS: 86168-78-7 MF: C149H246N44O42S MW: 3357.96 Purity: 99% Specification: 2mg/vial Appearance: ... more
    Brand Name:Zhenxiang
    Model Number:CAS: 86168-78-7
    Place of Origin:CHINA

    2MG / Vial Sermorelin Acetate Cas 86168-78-7 White Lyophilized Powder

Tell “sermorelin acetate side effects” Suppliers Your Requirement
*E-mail:
* Message:
Characters Remaining: (0/3000)
Inquiry Cart 0